PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_59277.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 302aa    MW: 31416.3 Da    PI: 12.3877
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_59277.4genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70279.68.3e-25194246102154
        DUF702 102 tsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   + slP++v+++avfrcvrv+svddg +e+aYq+avsi+Gh+f+G+LydqG+++
  MLOC_59277.4 194 KDSLPRHVRAPAVFRCVRVTSVDDGADEFAYQAAVSINGHMFRGFLYDQGAHD 246
                   356***********************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.8E-22189245IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016241.4E-24197243IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MSAWSCSHPR HPSTTRGLLL RRRPRTAPTP GSRSSPRSSA GSPALALPSP AAPSSSGSRT  60
RNPPRRRRLP KLTRSNSPPR WTTAAASPPA PAAPPRATIA ATRRRKTAPT SDAGRAARAA  120
ASTARRTSGA PGSRPPGAAR SSRSAATCPL PPPLPLQPPR NPGSTPPRPP PPQPPPAPPP  180
PTAPPRANKD APFKDSLPRH VRAPAVFRCV RVTSVDDGAD EFAYQAAVSI NGHMFRGFLY  240
DQGAHDGRAS NDEPSHAHAA AVRSISDLHL GNANASAVPP DMYNTVSGAL ILGGLGYGNN  300
MN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11925LRRRPRT
2101106TRRRKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3745320.0AK374532.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3068E07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0XE290.0M0XE29_HORVD; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-19Lateral root primordium (LRP) protein-related